>|Mouse Neurotrypsin Scavenger Receptor Cysteine-Rich Domain 3(mmNT-SRCR3)
GTGEFTSGSGFPIRLVDGENKKEGRVEVFVNGQWGTICDDGWTDKHAAVICRQLGYKGPARARTMAYFGEGKGPIHMDNVKCTGNEKALADCVKQDIGRHNCRHSEDAGVICDYLEKKASS