>|Proliferating cell nuclear antigen(PCNA)
MGSSHHHHHHSQDPMQ
IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ
KESTLHLVLRLRGGPGETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFG
AKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFNDEE
MLEAKFEEASLFK
RIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLT
SLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQY
DSTLSLPSSEFSKIVRDLSQLSDSINIMIT