>|Stator protein FlaG-V118K soluble domain(sFlaG-V118K)
MGSSHHHHHHSQDPNSISTTMSSYSIQQSQKMLTQLQIDYATNTSSNTVVAYLHNVGETTISYLQNSVVYFGPNGQLQPVGYNSGSSPYWTVTSNSLQPGSKVKIIIYLSSPLSSNQYYTIQIVTPNGYTVSYMF