>|Polyphosphate-targeting protein A(PptA)
GHMAQRHLDPTDPLAGPSPTGDTLAGYLRAQATEFLRALRLHRETGSGANGAEGPVEAARAL
RRSARRISATLHTFQSLLDTDWCEGMRPELAWVSGTLAMEHAYTARLERLLNALHRLSGS
TALPSQTADSAAGGRAAGAAPVPRTAAPRDAGLRTPPTSTTERGNLTVGAAKAGALLDRQ
LTLARTRAHSTALQAMGSSRFHAIADKVAVLASEVPLTPAAATADLRPLATAAKDRLTDA
VAALPLITAGHPYNAAALIHGLSPDTVPHPQDAPWHQVRLLLRLHRYAREAVSGPKGNAV
VDLRLLSAGQALNRHRDASEAAAAAAQAARTPRIAPATAYALGVLHADQRHEVEAARFAF
QQAWQKEAEAVSTR