>|EKC/KEOPS complex subunit LAGE3(LAGE3)
MRDADADAGGGADGGDGRGGHSCRGGV
DTAAAPAGGAPPAHAPGPGRDAASAARGSRMRPHIFTLSVPFPTPLEAEIAHGSLAPDAE
PHQRVVGKDLTVSGRILVVRWKAEDCRLLRISVINFLDQLSLVVRTMQRFGPPVSR