>|Heat shock protein 70(1-677)
MASAKGSKPNLPESNIAIGIDLGTTYSCVGVWRNENVDIIANDQGNRTTP
SYVAFTDTERLIGDAAKNQVARNPENTVFDAKRLIGRKFTESSVQSDMKH
WPFTVKSGVDEKPMIEVTYQGEKKLFHPEEISSMVLQKMKENAEAFLGKS
IKNAVITVPAYFNDSQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLHKK
GKGEKNILIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRLV
NFCVEDFKRKNRGKDLSKNSRALRRLRTQCERAKRTLSSSTQATIEIDSL
FEGIDYSVTVSRARFEELCIDYFRDTLIPVEKVLKDAMMDKKSVHEVVLV
GGSTRIPKIQTLIKEFFNGKEACRSINPDEAVAYGAAVQAAILSGDQSNA
VQDLLLLDVCSLSLGLETAGGVMTKLIERNTTIPAKKSQIFTTYADNQPG
VLIQVYEGERALTKDNNLLGKFHLDGIPPAPRKVPQIEVTFDIDANGILN
VTAVEKSTGKQNHITITNDKGRLSQDEIDRMVNDAEKYKAEDEENRKRIE
ARNSLENYCYGVKSSLEDQKIKEKLQPAEIETCMKTITTILEWLEKNQLA
GKDEYEAKQKEAESVCAPIMSKIYQDAAGAAGGMPGGMPGGMPGGMPGGM
NFPGGMPGAGMPGNAPAGSGPTVEEVD