>|thiol-disulfide exchange protein(alpha-DsbN)
SNAMSLPIINNWLSNRSQMLNDDYIGEKLDNYISRNFDKIVKTLKEESIKSSYAARDNV
TKSKISQYKDQIFDLTYPYSGNENSSVIAVGFLDYSCGHCKAIKNDIKQLINDGKIKYIFRDAPILGNAS
LKAAKSALAVYFLNKEKYFDFHHAALSHKGEFSDESILDIVKNIGIDEDDFNDSIKDNADKIEQMINNSR
LLVRDLGVGGTPFLIIGDSLFVGATDLNVLRKKVDELSHKQG