>|Conserved flagellar protein F(sFlaF)
MGSSHHHHHHSQDPNSNQAQELNHELELEQLETKITVSSVSLTGSTLNVV
LENNGSTNLY DFQGFSVIVQYYANISNISTFNLSLYNYTKNSNPSPYYW
TINTPLLAPGSQATLTIILPY PPYPNTQATVVIVTNYGPSVIWRGSL