>ER-NTD sequence
SNAMTMTLHTKASGMALLHQIQGNELEPLN RPQLKIPLER PLGEVYLDSS KPAVYNYPEGAAYEFNAAAA ANAQVYGQTG LPYGPGSEAA AFGSNGLGGF PPLNSVSPSPLMLLHPPPQLSPFLQPHGQQ VPYYLENEPS GYTVREAGPP AFYRPNSDNR RQGGRERLAS TNDKGSMAMESAKETRY