>|Proliferating cell nuclear antigen(PCNA)
MGSSHHHHHHSQDPMSDSEVNQEAKPEVKPEVKPET
HINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLD
MEDNDIIEAHREQIGGPGETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLT
FGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFNDEE
MLEAKFE
EASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVT
LGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLK
IEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMIT