>tr|G0SHK2|G0SHK2_CHATD Condensin complex subunit 3-like protein OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) 24-1006
PDNALRTQVTTVFREAQRTTASHRKLVVTLRKIQEACCYEPATGQKQSGAAAALSEFDED
DFNTEFVRCALRILPVKKSEGVGEKTVRFVSLFLRHAIEKDNELLGDTQMDEDDADNSTM
PETPSTRLTSHLMETILPMLMAKDKFVRYRAAQLLAHIVNSLDAIDDDLYQKLRAGLLRR
IHDKEPMVRAQAVLGLGRLAGNALDEEPGAGDSDLDGDDDGPGGASGVSLMDKLMDVMKN
DPSADVRRTLLVNLPITPKTLPSLLERARDQDPATRRAVYSRLLPALGDFRHLSLSMREK
LLRWGLRDRDENVRKAAARLFRERWIEDCAGTPRPEPGQPIELSPPNMDALLELLERIDV
VNSGGENGIALEAMRGFWEGRPDYRDAMVFDDHFFETLSAESVFALRTFNDFCRNEAGGK
YEALIEEKLPEVTKLAFYLERYIKVLIDAIKRAEEQGEEEEEDTAEQEFIVEQLLHIALT
LDYADEVGRRKMFALLRQTLSIPELPEECTKLTVMVLRDLCAPDAAGEKEFTSVVLEAVA
DVHDTIVDEDDDDANVPAEDDESFVSARSEVSRESTPAPGGGEGGGSNSRKRGRSPTPKM
TEEEAAAKAIREIMINMKCLHIVQCMLQNVQGQLQSNDNLISMLNNLVVPAVRSHEAPVR
ERGLVCLGLCALLDRSLAEENLTLFIHFFAKGHTALQITALHILTDILVVHGAQLLSANP
TLLKVYVKALRSGAKHPELQAVAVVAASKLLLGRVVSDRDVAAELLKTLVVAYFEPASAG
NQSVRQALNYFLPVFCYSRAENQDLMRRVALDALHTLYNVREGFDDDDADIDDEMVSLAT
IGACLVDWTDPRKVYTPDAGGLQAEKHVNADVHLDFAKAILERLEGNVPREEKKVLASLL
SKLYISPASSPDKTRETYRVVSAAVDTNLLPDTTSRNALYKIHVSLGKIVNALDGAVPSV
ETASVAGSTGTGIGTTTTAATGR