>|HP0242 from Helicobacter pylori,  N-terminal domain of syntaxin-1A from Rattus norvegicus, de novo designed coiled-coil trimer domain(Fusion protein2)
MGSSHHHHHHSSGLVPRGSHMRDYSELEIFEGNPLDKWNDIIFHASKKASKKELERLLELLALCETFIEKEDLEEKFESFAKALRIDEELQQKIESRKTDIVIQSMANILSALFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYGSGGEIAAIKQEIAAIKKEIAAIKWEIAAIKQGYG