>|Uncharacterized protein
MATNGMRPIHPGEILRDEFLMEFDISPAALARALKVSAPTVNDIVREQRGISADMAIRLG
RYFDTSAQFWMNLQSEYSLATAYAANGKQIEHEIEPLLAHG