>|DNA-binding protein HU-alpha, E34K
MNKTQLIDVIAEKAELSKTQAKAALESTLAAITKSLKEGDAVQLVGFGTFKVNHRAERTG
RNPQTGKEIKIAAANVPAFVSGKALKDAVK