>VTO94530.1 Cqm1 receptor, mature form (23-560), partial [synthetic gene] (with tag)
MHHHHHHSSGVDLGTENLYFQSMREPDSKDWYQHATFYQIYPRSFLDSNGDGIGDLAGITSKMKYLADIGIDA
TWLSPPFKSPLKDFGYDVSDFYAIQPEYGNLTDFDKLVEESHKNGIKLMLDFIPNHSSDQHEWFVKSVVRDPE
YSDFYVWRPPATGGGPPNNWISVFGGSAWTYNQARGEYYLHQFTPQQPDLNYRNPKVLAEMTKMLFFWLDRGV
DGFRLDAINHMFEDEQFRDEPLSGWGQPGEYDSLDHIYTKDIPDVYDVVYNWRDQMDKYSAEKGRTIILMTEA
YSSIEGTMLYYESADRKRQGAHMPFNFQLIYDFKKEQNAVGLKSSIDWWMNNMPARHTPSWVAGSHDHSRVAS
RVGLDRVDQVMTLLHTLPGTSITYYGEEVAMQDFKEAQQFDNRDPNRTPMQWDSSTSAGFSTNTNTWLRVHPD
YARYNVDVMQKNPQSTFHHFQHLTKLRRHRTMQSGEYVHKTVGTKVYALLRELRGEDSFLTVLNMAGAEDTVD
LGDFVNLPQKMRVEVAQPNSKSKAGNEVDISKLTLGPYDSVVLRATVSSA