>|Double-stranded RNA-binding protein Staufen homolog 1 - RNA binding domain 4(STAU1-RBD4)
GSHMNPISRLAQIQQAKKEKEPEYTLLTERGLPRRREFVMQVKVGNHTAEGTGTNKKVAKRNAAENMLEILGFK