>|Interleukin-11 receptor subunit alpha(IL11RA)
GSSPCPQAWGPPGVQYGQPGRSVKLCCPGVTAGDPVSWFRDGEPKLLQGPDSGLGHEL
VLAQADSTDEGTYICQTLDGALGGTVTLQLGYPPARPVVSCQAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGADSQRRSPSTGPWPCPQDPLGAAR
CVVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASWTYPASWPSQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEV
ITDAVAGLPHAVRVSARDFLDAGTWSTWSPEAWGTPSTGT