>|PupR protein(PupR)
GAMGQDWRADYHSRIGEQRRLTLADGTQVQLNTDSALNVA
FDQQARRLRLVRGEMLITRPALADSRPLWVDTEHGRLESTL
AQFNVRLHGQHTQATVYQGSVALQPALHAYPPILLGAGEQA
SFNQQGLLARQAVAAVAPAWSQGMLVAQGQPLAAFIEDLAR
YRRGHLACDPALAGLRVSGTFPLENTDKIIAAVAETLQLEVQ
HFTRYWVTLKPRMA