>|Tegument protein UL7(pUL7)
MAAATADDEGSAATILKQAIAGDRSLVEAAEAISQQTLLRLACEVRQVGDRQPRFTATSIARVDVAPGCRLRFVLDGSPEDAYVTSEDYFKRCCGQSSYRGFAVAVLTANEDHVHSLAVPPLVLLHRFSLFNPRDLLDFELACLLMYLENCPRSHATPSTFAKVLAWLGVAGRRTSPFERVRCLFLRSCHWVLNTLMFMVHVKPFDDEFVLPHWYMARYLLANNPPPVLSALFCATPTSSSFRLPGPPPRSDCVAYNPAGIMGSCWASEEVRAPLVYWWLSETPKRQTSSLFYQFCGSLEVLFQ