>|Soluble guanylyl cyclase alpha-1 subunit
MTCPFRRASSQHQFANGGSSAPKKPEFRSRTSSVHLTGPEEEDGERNTLTLKHMSEALQL
LTAPSNECLHAAVTSLTKNQSDHYHKYNCLRRLPDDVKTCRNYAYLQEIYDAVRATDSVN
TKDFMAKLGEYLILTAFSHNCRLERAFKCLGTNLTEFLTTLDSVHDVLHDQDTPLKDETM
EYEANFVCTTSQEGKIQLHLTTESEPVAYLLVGSLKAIAKRLYDTQTDIRLRSYTNDPRR
FRYEINAVPLHQKSKEDSCELVNEAASVATSTKVTDLKIGVASFCKAFPWHFITDKRLEL
VQLGAGFMRLFGTHLATHGSSLGTYFRLLRPRGVPLDFREILKRVNTPFMFCLKMPGSTA
LAEGLEIKGQMVFCAESDSLLFVGSPFLDGLEGLTGRGLFISDIPLHDATRDVILVGEQA
RAQDGLRRRMDKLKNSIEEASKAVDKEREKNVSLLHLIFPPHIAKRLWLGEKIEAKSHDD
VTMLFSDIVGFTSICATATPMMVIAMLEDLYSVFDIFCEELDVYKVETIGDAYCVASGLH
RKVETHAPQIAWMALRMVETCAQHLTHEGNPIKMRIGLHTGTVLAGVVGKTMLKYCLFGH
NVTLANKFESGSEPLKINVSPTTYEWLIKFPGFDMEPRDRSCLPNSFPKDIHGTCYFLHK
YTHPGTDPGEPQVKHIREALKDYGIGQANSTDVDTEEPT