>|Soluble guanylyl cyclase beta-1 subunit
MYGFVNYALELLVMKTFDEETWETIKKKADVAMEGSFLVRQIYEDEITYNLITAAVEVLQ
IPADAILELFGKTFFEFCQDSGYDKILQVLGATPRDFLQNLDGLHDHLGTLYPGMRSPSF
RCTERPEDGALVLHYYSDRPGLEHIVIGIVKTVASKLHNTEVKVEILKTKEECDHVQFLI
TETSTTGRVSAPEIAEIETLSLEPKVSPATFCRVFPFHLMFDRDLNIVQAGRTVSRLLPR
VTRPGCKITDVLDTVRPHLEMTFANVLAHINTVYVLKTKPEEMSVTDPHEEIASLRLKGQ
MLYIPETDVVVFQCYPSVTNLDDLTRRGLCIADIPLHDATRDLVLMSEQFEADYKLTQNL
EVLTDKLQQTFRELELEKQKTDRLLYSVLPISVATELRHRRPVPARRYDTVTLLFSGIVG
FANYCARNSDHKGAMKIVRMLNDLYTAFDVLTDPKRNPNVYKVETVGDKYMAVSGLPEYE
VAHAKHISLLALDMMDLSQTVTVDGEPVGITIGIHSGEVVTGVIGHRMPRYCLFGNTVNL
TSRCETTGVPGTINVSEDTYNYLMREDNHDEQFELTYRGHVTMKGKAEPMQTWFLTRKIH