>|Uncharacterized protein
MAHHHHHHVDDDDKMNSDDNADGLIFSPLPQNKNTVVRHYSNEQEMPNLSQMAQRTIDFPTQIVRVSGNLTGLELSCDDVENEIDQVFSKKISPNLFTYNTYVSCGYDVNDPEQHATNFSIQSYFDPLTDNAVDYLKSYLKEYNGYNLFNTTTLQIENAKGIIVSMNLNAGLKSNPDKTPFTLYRQDRNNFYFKSNFDVRKELISDIYQRFYSNDPDMILPFFDKWIFSYAGSVYYSILMASNYLELQPERIFVMENEGDIFVSDLRYYFANLCMKRNPNKHCL