>|Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1(GPIHBP1)
QTQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSRVL
LRCYTCKSLPRDERCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPPWQSSRVQDPTG