>|Monoclonal Antibody Fragment 5D2(Fab-5D2)
DIKMTQSPSSMYASLGERVTITCKASQDIRKYLNWYQQKPWKSPKTLIYYATSLADGVPSRFSGSGSGQDYSLTISSLES
DDTATYYCLQHGESPYTFGGGTKLEINRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVL
NSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNECEIQLQQSGAELVRPGALVKLSCKASG
FNIKDYYMHWVKQRPEQGLEWIGLIDPENGNTIYDPKFQGKASITADTSSNTAYLQLSSLTSEDTAVYYCARDNSYYFDY
WGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVT
VPSSTWPSETVTCNVAHPASSTKVDKKI