>|Plasmodium falciparum Heat shock protein 90(PfHsp90)
MGSSHHHHHHSSGLVPRGSHMSTETFAFNADIRQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESITDTQKLSAEPEFFIRIIPDKTNNTLTIEDSGIGMTKNDLINNLGTIARSGTKAFMEAIQASGDISMIGQF
GVGFYSAYLVADHVVVISKNNDDEQYVWESAAGGSFTVTKDETNEKLGRGTKIILHLKED
QLEYLEEKRIKDLVKKHSEFISFPIKLYCERQNEKEITASEEEEGEGEGEREGEEEEEKK
KKTGEDKNADESKEENEDEEKKEDNEEDDNKTDHPKVEDVTEELENAEKKKKEKRKKKIH
TVEHEWEELNKQKPLWMRKPEEVTNEEYASFYKSLTNDWEDHLAVKHFSVEGQLEFKALL
FIPKRAPFDMFENRKKRNNIKLYVRRVFIMDDCEEIIPEWLNFVKGVVDSEDLPLNISRE
SLQQNKILKVIKKNLIKKCLDMFSELAENKENYKKFYEQFSKNLKLGIHEDNANRTKITE
LLRFQTSKSGDEMIGLKEYVDRMKENQKDIYYITGESINAVSNSPFLEALTKKGFEVIYM
VDPIDEYAVQQLKDFDGKKLKCCTKEGLDIDDSEEAKKDFETLKAEYEGLCKVIKDVLHE
KVEKVVVGQRITDSPCVLVTSEFGWSANMERIMKAQALRDNSMTSYMLSKKIMEINARHP
IISALKQKADADKSDKTVKDLIWLLFDTSLLTSGFALEEPTTFSKRIHRMIKLGLSIDEE
ENNDIDLPPLEETVDATDSKMEEVD