>|Plasmodium falciparum Heat shock protein 90 N-terminal and Middle domains(PfHsp90NMD)
MGSSHHHHHHSSGLVPRGSHMSTETFAFNADIRQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESITDTQKLSAEP
EFFIRIIPDKTNNTLTIEDSGIGMTKNDLINNLGTIARSGTKAFMEAIQASGDISMIGQF
GVGFYSAYLVADHVVVISKNNDDEQYVWESAAGGSFTVTKDETNEKLGRGTKIILHLKED
QLEYLEEKRIKDLVKKHSEFISFPIKLYCERQNEKEITASEEEEGEGEGEREGEEEEEKK
KKTGEDKNADESKEENEDEEKKEDNEEDDNKTDHPKVEDVTEELENAEKKKKEKRKKKIH
TVEHEWEELNKQKPLWMRKPEEVTNEEYASFYKSLTNDWEDHLAVKHFSVEGQLEFKALL
FIPKRAPFDMFENRKKRNNIKLYVRRVFIMDDCEEIIPEWLNFVKGVVDSEDLPLNISRE
SLQQNKILKVIKKNLIKKCLDMFSELAENKENYKKFYEQFSKNLKLGIHEDNANRTKITE
LLRFQTSKSGDEMIGLKEYVDRMKENQKDIYYITGESINAVSNSPFLEALTKKGFEVIYM
VDPIDEYAVQQLKDFDGKKLKCCTKE