>|Plasmodium falciparum Heat shock protein 90 middle domain(PfHsp90MD)
MGSSHHHHHHSSGLVPRGSHMQKPLWMRKPEEVTNEEYASFYKSLTNDWEDHLAVKHFSVEGQLEFKALLFIPKRAPFDM
FENRKKRNNIKLYVRRVFIMDDCEEIIPEWLNFVKGVVDSEDLPLNISRESLQQNKILKV
IKKNLIKKCLDMFSELAENKENYKKFYEQFSKNLKLGIHEDNANRTKITELLRFQTSKSG
DEMIGLKEYVDRMKENQKDIYYITGESINAVSNSPFLEALTKKGFEVIYMVDPIDEYAVQ
QLKDFDGKKLKCCTKE