>|Binary larvicide subunit BinB(binB)
MGSSHHHHHHSSGLVPRGSMCDSKDNSGVSEKCGKKFTNYPLNTTPTSLNYNLPEISKKF
YNLKNKYSRNGYGLSKTEFPSSIENCPSNEYSIMYDNKDPRFLIRFLLDDGRYIIADRDD
GEVFDEAPTYLDNNNHPIISRHYTGEERQKFEQVGSGDYITGEQFFQFYTQNKTRVLSNC
RALDSRTILLSTAKIFPIYPPASETQLTAFVNSSFYAAAIPQLPQTSLLENIPEPTSLDD
SGVLPKDAVRAVKGSALLPCIIVHDPNLNNSDKMKFNTYYLLEYKEYWHQLWSQIIPAHQ
TVKIQERTGISEVVQNSMIEDLNMYIGADFGMLFYFRSSGFKEQITRGLNRPLSQTTTQL
GERVEEMEYYNSNDLDVRYVKYALAREFTLKRVNGEIVKNWVAVDYRLAGIQSYPNAPIT
NPLTLTKHTIIRCENSYDGHIFKTPLIFKNGEVIVKTNEELIPKINQ