>|Synthetic construct (mutant, His-tagged): Mosquito-larvicidal BinAB toxin receptor protein (Neutral and basic amino acid transport protein rBAT)(Cqm1)
MHHHHHHSSGVDLGTENLYFQSMREPDSKDWYQHATFYQIYPRSFLDSNGDGIGDLAGITSKMKYLADIGIDA
TWLSPPFKSPLKDFGYDVSDFYAIQPEYGNLTDFDKLVEESHKNGIKLMLDFIPNHSSDQHEWFVKSVVRDPE
YSDFYVWRPPATGGGPPNNWISVFGGSAWTYNQARGEYYLHQFTPQQPDLNYRNPKVLAEMTKMLFFWLDRGVDGFRLDAINHMFEDEQFRDEPLSGWGQPGEYDSLDHIYTKDIPDVYDVVYNWRDQMDKYSAEKGRTIILMTEA
YSSIEGTMLYYESADRKRQGAHMPFNFQLIYDFKKEQNAVGLKSSIDWWMNNMPARHTPSWVAGSHDHSRVAS
RVGLDRVDQVMTLLHTLPGTSITYYGEEVAMQDFKEAQQFDNRDPNRTPMQWDSSTSAGFSTNTNTWLRVHPD
YARYNVDVMQKNPQSTFHHFQHLTKLRRHRTMQSGEYVHKTVGTKVYALLRELRGEDSFLTVLNMAGAEDTVD
LGDFVNLPQKMRVEVAQPNSKSKAGNEVDISKLTLGPYDSVVLRATVSSA