>|Pentafunctional AROM polypeptide(AROM complex)
MATANVAGAGGSGSEPTRIAILGKEDIIVDHGIWLNFVAHDLLQTLPSSTYVLITDTNLY
TTYVPPFQAVFEAAAPRDVRLLTYAIPPGEYSKSRETKAEIEDWMLSHACTRDTVIIALG
GGVIGDMIGYVAATFMRGVRFVQVPTTLLAMVDSSIGGKTAIDTPMGKNLIGAFWQPRRI
YIDLAFLETLPVREFINGMAEVIKTAAIWNETEFTALEENAAAILEAVRSKASSPAARLA
PIRHILKRIVLGSARVKAEVVSADEREGGLRNLLNFGHSIGHAYEAILAPQVLHGECVAI
GMVKEAELARYLGVLRPSAVARLTKLIASYDLPTSVHDKRIAKLSAGKECPVDVLLQKMA
VDKKNEGRKKKIVLLSAIGKTYEKKATVVDDRAIRLVLSPSVRVTPGVPKGLSVTVTPPG
SKSISNRALVLAALGEGTTRIHGLLHSDDVQYMLAAIEQLHGADFSWEDAGEILVVTGKG
GKLQASKEPLYLGNAGTASRFLTSVVALCAPSAVSSTVLTGNARMKVRPIGALVDALRAN
GVGVKYLEKEKSLPVEVDAAGGFAGGVIELAATVSSQYVSSILMAAPYAHQPVTLRLVGG
KPISQPYIDMTIAMMASFGIKVERSAEDPNTYLIPKGVYKNPPEYVVESDASSATYPLAV
AAITGTTCTIPNIGSESLQGDARFAVEVLRPMGCAVEQTATSTTVTGPPIGTLKAIPHVD
MEPMTDAFLTAAVLAAVADGTTQITGIANQRVKECNRIAAMKDQLAKFGVQCNELEDGIE
VIGKPYQELRNPVEGIYCYDDHRVAMSHSVLSTISPHPVLILERECTAKTWPGWWDILSQ
FFKVQLDGEEDPTKRTTQSTQQVRKGTDRSIFIVGMRGAGKSTAGRWMSELLKRPLVDLD
AELERREGMTIPEIIRGERGWEGFRQAELELLQDVIKNQSKGYIFSCGGGIVETEAARKL
LIDYHKNGGPVLLVHRDTDQVVEYLMRDKTRPAYSENIREVYERRKPWFYECSNLQYHSP
HEDGSEALLQPPADFARFVKLIAGQSTHLEDVRAKKHSFFVSLTVPNVADALDIIPRVVV
GSDAVELRVDLLESYEPEFVARQVALLRAAAQVPIVYTVRTQSQGGKFPDEDYDLALRLY
QTGLRSGVEYLDLEMTMPDHILQAVTDAKGFTSIIASHHDPQCKLSWKSGSWIPFYNKAL
QYGDVIKLVGVAREMADNFALTNFKAKMLAAHDNKPMIALNMGTAGKLSRVLNGFLTPVS
HPALPSKAAPGQLSATEIRQALSLIGEIEPKSFYLFGKPISASRSPALHNTLFYKTGLPH
HYSRFETDEASKALESLIRSPDFGGASVTIPLKLDIMPLLDSATDAARTIGAVNTIIPQT
RDGSTTTLVGDNTDWRGMVHALLHSSGSGSVVQRTAAPRGAAMVVGSGGTARAAIYALHD
LGFAPIWIVARSEERVAELVRGFDGYDLRRMTSPHQGKDNMPSVVISTIPATQPIDPSMR
EVIVEVLKHGHPSAEGKVLLEMAYQPPRTPLMTLAEDQGWRTVGGLEVLAAQGWYQFQLW
TGITPLYEEARAAVMGEDSVELEHHHHHH