>|Proliferating cell nuclear antigen (C-terminal His-tagged)(PCNA or POL30)
MLEGKFEEAALLKKVVEAIKDCVKKCNFNCSEHGITVQAVDDSRVLLVSLLIGQTSFSEY
RCDRDVTLGIDLESFSKIIKSANNEDFLTLLAEDSPDQIMAILEEKQKEKISEYSLKLMD
IDSEFLQIDDMEYDAVVNMPSSDFAKLVRDLKNLSESLRVVVTKDSVKFTSEGDSGSGSV
ILKPYTNLKNERESVTISLDDPVDLTFGLKYLNDIVKAATLSDVITIKLADKTPALFEFK
MQSGGYLRFYLAPKFDDDELEHHHHHH