>|5-methylcytosine-specific restriction enzyme A (N-terminal domain)(EcoKMcrA-N)
MHVFDNNGIELKAECSIGEEDGVYGLILESWGPGDRNKDYNIALDYIIERLVDSGVSQVVVYLASSSVRKHMHSLDERKIHPGEYFTLIGNSPRDIRLKMCGYQAYFSRTGRKEIPSGNRTKRILINVPGIYSDSFWASIIRGELSELSQPTDDESLLNMRVSKLIKKTLSQPEGHHHHHHG