Survival motor neuron protein (fusion construct with the protein transduction domain of the human immunodeficiency virus type 1 Tat protein)

flSMN protein

Organism: synthetic construct

Monomeric molecular weight: 33.3 kDa

Oligomeric state: Other

Total molecular weight: 533.5 kDa

UniProt: Q16637 (1-294)

Sequence:

GRKKRRQRRRGGMAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSLN

A synthetic construct comprising full-length SMN protein conjugated with the protein transduction domain of the human immunodeficiency virus type 1 (HIV-1) TAT protein (TAT-flSMN) has been generated, purified and characterized. It undergoes self-oligomerization, similarly to native SMN. Self-oligomerization is a key property to ensure the SMN biological function.