Acylamino-acid-releasing enzyme (I277L, V491A)

S9Cgs protein
Organism: Geobacillus stearothermophilus
Monomeric molecular weight: 77.1 kDa
Oligomeric state: Tetramer
Total molecular weight: 308.4 kDa
UniProt: A0A150M835 (17-670)
Sequence:

Acylamino-acid-releasing enzyme containing the amino acid mutations I277L, V491A. The protein construct used for SAXS contains an additional non-native polyhistidine extension and amino acid linker sequence at the N-terminus (MASWSHPQFEKGSSHHHHHHSSGSGGGGGENLYFQGT).