RH1 (Linear coiled-coil protein origami structure consisting of 6 coiled-coil forming segments)

RH1 protein

Organism: synthetic construct

Monomeric molecular weight: 25.7 kDa

Oligomeric state: Monomer

Total molecular weight: 25.7 kDa

Sequence:

CWEMSPEDKLAQIKEKLQQIKEELAANEEKLQANKYGSGPGQLEDKVEELLSKNYHLENEVERLKKLVGGSGPGSPEDEIQQLEEEISQLEQKNSELKEKNQELKYGSHHHHHHSGSPEDENEKLEEKIWELKRKNEELKREIKELEEGSGPGQLEDKVEELLSKNYHLENEVERLKKLVGGSGPGSPEDEIKELEWKNEELKREIKELEEKNEELKRRGK

RH1 - Coiled-coil protein origami structure consisting of 6 coiled-coil forming segments. The protein is linear and has the same sequence as the cyclic version cyRH1.