The S9 peptidase of M. Phlei (S9mp) was cloned and recombinantly expressed in E. coli. The recombinant S9mp protein was purified to homogeneity using Ni-IMAC, followed by size exclusion chromatography (SEC). Both SEC and dynamic light scattering confirmed tetrameric quaternary state and monodispersity. The protein construct used for SAXS contains additional N-terminal non native amino acids, including a polyhistidine tag (MASWSHPQFEKGSSHHHHHHSSGSGGGGGENLYFQGS).