The S9 peptidase of Rhizobium radiobacter (S9rr; WP_077998848.1) was cloned and recombinantly expressed in E. coli. The recombinant S9rr protein was purified to homogeneity using Ni-IMAC, followed by size exclusion chromatography (SEC). Both SEC and dynamic light scattering confirmed monomeric quaternary state and monodispersity. The protein construct used for SAXS contains additional N-terminal non native amino acids, including a polyhistidine tag (MASWSHPQFEKGSSHHHHHHSSGSGGGGGENLYFQGS). NCBI Reference Sequence: WP_077998848.1 (https://www.ncbi.nlm.nih.gov/protein/WP_077998848.1).