crTPpart2 of cysteine synthase A (CysK)

crTPpart2_CysK protein

Organism: Paulinella chromatophora

Monomeric molecular weight: 15.8 kDa

Oligomeric state: Monomer

Total molecular weight: 15.8 kDa

Sequence:

GATSSSISAGGAAGADSSFIPKIGVNAVVARPNPPGPLQLLPPGISSPATLFIYPSMESLLGKDFGNGATSESAWVYGAKLTSDEAGALPVLTGQPSDVLKGRLVSFPPMGFPSKLRLVDGLMNFGGLSTTLREMVPVVKKDGSTIDTYWYYQ

No UniProt ID is available. This sequence was derived from the transcripts (GenBank: GEZN00000000.1, Nowack, E. C. M., Price, D. C., Bhattacharya, D., Singer, A., Melkonian, M. and Grossman, A. R. (2016) Gene transfers from diverse bacteria compensate for reductive genome evolution in the chromatophore of Paulinella chromatophora. Proc. Nati. Acad. Sci. USA, 113, 12214-12219.) Scaffold4337-size1989, encoding a protein annotated as cysteine synthase A (CysK).