Segment polarity protein dishevelled homolog DVL-3

DLV3_PDZ protein

Organism: Homo sapiens

Monomeric molecular weight: 12.0 kDa

Oligomeric state: Monomer

Total molecular weight: 12.0 kDa

UniProt: Q92997 (245-351)

Sequence:

GAMALNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRSE

PDZ domain of the Segment polarity protein dishevelled homolog DVL-3. The protein construct used for SAXS contains an additional four non-native amino acids at the N-terminus (GAMA).