Breast cancer type 2 susceptibility protein (BRC repeat 2)

BRC2 protein

Organism: Homo sapiens

Monomeric molecular weight: 4.4 kDa

Oligomeric state: Monomer

Total molecular weight: 4.4 kDa

UniProt: P51587 (1212-1246)

Sequence:

GWHMNEVGFRGFYSAHGTKLNVSTEALQKAVKLFSDIEN

Second BRC repeat of Breast cancer type 2 susceptibility protein. The construct used for SAXS contains an additional four non-native amino acids at the N-terminus (GWHM).