Nanobody 28F6

28F6 protein

Organism: synthetic construct

Monomeric molecular weight: 15.3 kDa

Oligomeric state: Monomer

Total molecular weight: 15.3 kDa

Sequence:

QVQLQESGGGSVQAGGSLRLSCAAPGGTFSSYAMGWFRQAPGKERDIVAAINWSGNVRYYGDSVKGRFTISRDNTKNTVYLQMSSLEPEDSAIYTCASGGTTATMRRGSIDYWGQGTQVTVSSAAAYPYDVPDYGSHHHHHH

28F6 is a nanobody designed to stabilize the iron-binding protein frataxin, acting as a chaperone in Friedreich's ataxia disease. The protein construct used for SAS contains an additional C-terminal polyhistidine tag.