Ferric anguibactin-binding protein

FatB protein

Organism: Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)

Monomeric molecular weight: 32.4 kDa

Oligomeric state: Monomer

Total molecular weight: 32.4 kDa

UniProt: Q815N5

Sequence:

SDKPKTVEITDAHGTVKVPVNPKNVVALDNRTFETLSDWGIKLAAAPKDIMPADSAYKKDEKVQNIGNHREPNLEIIAAANPELVIVGQRFADHYEEIKKLVPNAAVIDLNFDVSEKATKPGENLVKGLKDSTVTLGKIFNKDKEAKQLVADFDKSIEKAKSAYNGKDKVMSVIVTGGNIGFAAPHSGRVWGPMYEIFGWTPALEVSNSTAGHKGDDVSVEAIAQTNPDWIFVLDRDAATSDAAKSTPAKDVISKSPALQNTTAVSKKQVIYAPEDTYTNESIQTYIELFGNMAKTLAK

SAXS data of FePBvFatB were collected at two sample-to-detector distances (3 m and 1 m). The 3 m setting covered the low-q region (q ≈ 0.025 to 0.126 Å-1), and the 1 m setting covered the higher-q region (q ≈ 0.126 to 0.60 Å-1). The datasets were scaled and checked for agreement in the overlap region before merging into a single profile.