>|Insulin gene enhancer protein ISL-2(ISL-2)
GGSGGHMGSGGGTPLVAGSPIRHENAVQGSAVEVQTYQPPW