>|Transcriptional regulator Lrs14-like protein(AbfR2)
MGSSHHHHHHSQDPNSMETVLQIPYQKKTQIEKLLEFMYGLNEKEVQLIFRLLYSDTKLN 
IEELAEEFKVSKALISKSLSELANKGLIEREKVSNEGRKGRPIYVYYVDREQLFKRISRD 
LEELVQASIAKLKEYIFKS